Protein Info for GFF3133 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative cell division protein precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 4 to 27 (24 residues), 17.4 bits, see alignment (E = 2.2e-07) PF07732: Cu-oxidase_3" amino acids 52 to 166 (115 residues), 92.2 bits, see alignment E=2.5e-30 PF07731: Cu-oxidase_2" amino acids 359 to 469 (111 residues), 49.6 bits, see alignment E=3.5e-17

Best Hits

Swiss-Prot: 100% identical to FTSP_SALTY: Cell division protein FtsP (ftsP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04753, suppressor of ftsI (inferred from 100% identity to sed:SeD_A3523)

Predicted SEED Role

"Putative cell division protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (470 amino acids)

>GFF3133 Putative cell division protein precursor (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSFSRRQFLQASGIALCAGAIPLRANAAGQQQPLPVPPLLESRRGQPLFMTLQRAHWSFT
QGTRAPVWGVNGRYLGPTIRVWKGDDVKLIYSNRLAENVSMTVAGLLVPGPLMGGPARMM
SPNADWAPVLPIRQSAATLWYHANTPNRTAQQVYNGLAGMWLVEDDISKTLPIPNHYGVD
DFPVIIQDKRLDNFGTPEYSEPGSGGFVGDTLLVNGAQSPYVEVSRGWVRLRLLNASNSR
RYQLQMSDGRALHVISGDQGFLPAPVSVKQLSLAPGERREILVDMTNGDEVSITCGEAAS
IVDRIRGFFEPSSILVSTLVLTLRPTGLLPLVTDNLPMRLLPTEIMSGAPVRSRDISLGD
DPGINGQLWDVNRIDITAQQGTWERWTVRADMPQSFHIEGVSFLIRNVNGAMPFPEDRGW
KDTVWVDGQVELLVYYGQPSWPHFPFYFNSQTLEMADRGSIGQMLVNPAS