Protein Info for GFF3131 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 142 to 176 (35 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details PF01925: TauE" amino acids 147 to 269 (123 residues), 48 bits, see alignment E=6.6e-17

Best Hits

KEGG orthology group: None (inferred from 69% identity to rsq:Rsph17025_4316)

Predicted SEED Role

"FIG00990961: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>GFF3131 hypothetical protein (Xanthobacter sp. DMC5)
MKAASLNSFAFSTGGIIGTLGGLIGLGGAEFRLPVLIGLFHFRALDAIIVNKAVSLIVVA
VALPFRASVVPFAQIADHWGVIANLLAGSLLGAWFGAGVALRLASPALYRVIALLLALIA
VVLLFGHGGGTGQPLFEGVLQQVAGVAGGFAIGIFASVLGVAGGELLIPTLILLFGCDVK
LAGSLSLAVSLPTMLVGFARYSQDKSFVVLARNRGFLIAMGLGSVAGAFAGSLLLGIVRA
EVLLPLLALLLAGSAVKIWLHARRAAPGPRFPPPPSRSTLPTDPTG