Protein Info for GFF3130 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: TRAP-type C4-dicarboxylate transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 32 to 284 (253 residues), 226.3 bits, see alignment E=2.1e-71 PF03480: DctP" amino acids 33 to 312 (280 residues), 268.7 bits, see alignment E=3.2e-84

Best Hits

Swiss-Prot: 36% identical to DCTP_BURCM: Solute-binding protein Bamb_6123 (Bamb_6123) from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD)

KEGG orthology group: None (inferred from 100% identity to spq:SPAB_03959)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>GFF3130 TRAP-type C4-dicarboxylate transport system, periplasmic component (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKNTRSFTTSAVLLAGCLLLAFPALAKTTLKLSHNQDKSHAVHKAMSYLADKAKAYSDGE
LNIRIYPNATLGNERESLELMNSGALQMVKVNAASLESFAPEYSVFSLPFLFRDRDHYYN
VLKSDLGKRILASSESKGFVGLTWYDGGARSFYAGKPITQPDDLAGMKIRVQQSPSAIAM
VKALGGVPTPMAQGELYTALQQGVVDGGENNPVVYADMRHAEVAKFYSRDEHTMVPDVLV
ISTKVLNKLSDKERKALYKAADESMQQMKDVIWPAAEKEAYESMKAMNATVVDIDKSAFK
QRVKPLFDEFRAKDAQSAKDLEYIENM