Protein Info for GFF3126 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 2-oxoglutarate/malate translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 transmembrane" amino acids 21 to 37 (17 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 68 to 85 (18 residues), see Phobius details amino acids 104 to 120 (17 residues), see Phobius details amino acids 141 to 158 (18 residues), see Phobius details amino acids 236 to 259 (24 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 314 to 331 (18 residues), see Phobius details amino acids 341 to 358 (18 residues), see Phobius details amino acids 380 to 401 (22 residues), see Phobius details amino acids 409 to 435 (27 residues), see Phobius details amino acids 465 to 488 (24 residues), see Phobius details PF00939: Na_sulph_symp" amino acids 20 to 493 (474 residues), 474 bits, see alignment E=6.6e-146 TIGR00785: transporter, divalent anion:Na+ symporter (DASS) family" amino acids 40 to 488 (449 residues), 387.6 bits, see alignment E=3.5e-120 PF03600: CitMHS" amino acids 61 to 435 (375 residues), 56.6 bits, see alignment E=2.4e-19

Best Hits

Swiss-Prot: 48% identical to YFLS_BACSU: Putative malate transporter YflS (yflS) from Bacillus subtilis (strain 168)

KEGG orthology group: K03319, divalent anion:Na+ symporter, DASS family (inferred from 100% identity to stm:STM3166.S)

MetaCyc: 38% identical to L-tartrate:succinate antiporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-127

Predicted SEED Role

"2-oxoglutarate/malate translocator" in subsystem Photorespiration (oxidative C2 cycle)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (494 amino acids)

>GFF3126 2-oxoglutarate/malate translocator (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MHIKYLWMCDCGGKKSQGVKWLPFILILVIAAGLWQLTPPSGLSAPAWHSAIIFVATIAS
IVAKVLPIGAVGIIGITVFALAYAAGDKTASGAITTALSELNSSLIWLIVVAFMIARGFI
KTGLGRRIALQMIRLLGKRTLGLAYGLAFADLILSPAMPSNTARCGGVIYPIADSLARSF
DSHPEDESRSKIGTFLITCIGNVNDVTAALFMTGYTGNLLAVKLAANAGVTLSWGSWFIA
ALLPCLVSFLIVPLLVYWLTRPEIKHTPDAPDLARKELAQMGSMTRGEWLMLATVGVLLV
LWIFGSSLGVDATTASFVGLSILLLSGVLTWEDVKSEKGAWDTLIWFAALLMMANQLKKL
GFTSWFGNLIGDSIGSTMHGTSWIIILLLLNAAYFYTHYFFASGNAQIAALYAVFLGVGL
HLNIPAAPMALMLAFTSSLYCSLTQYTHARGPILFGAGYVPTGVWWRTGFIISLFNQAVF
LTVGLAWWKVLGLY