Protein Info for PS417_15985 in Pseudomonas simiae WCS417

Annotation: amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 192 to 209 (18 residues), see Phobius details PF01810: LysE" amino acids 19 to 206 (188 residues), 87.3 bits, see alignment E=4.9e-29

Best Hits

KEGG orthology group: None (inferred from 93% identity to pfs:PFLU3651)

Predicted SEED Role

"FIG00964523: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0E3 at UniProt or InterPro

Protein Sequence (210 amino acids)

>PS417_15985 amino acid transporter (Pseudomonas simiae WCS417)
MTSALTLSSFLYFLLFCATMTFSPGPMTLLLLSLGVRDGLRRSIPAQIGASVSYLISILI
FAVGFSELIKGYPVITQVIQVVGVAYILHLAYKQWTSSGVVIERIGQVEAARNLFGKGLL
TGFSNPKTLIMFSAVFPQFAGTGASRSTVDIAILGLTFLLLQFASGCLYCYFGQRIKHVL
ENPKRRVLLQRITAVLLLGVAMMLARGFAH