Protein Info for PS417_15975 in Pseudomonas simiae WCS417

Annotation: glutamate carboxypeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF04389: Peptidase_M28" amino acids 93 to 209 (117 residues), 37.3 bits, see alignment E=4.8e-13 PF01546: Peptidase_M20" amino acids 106 to 404 (299 residues), 113 bits, see alignment E=3.8e-36 PF07687: M20_dimer" amino acids 210 to 307 (98 residues), 84.8 bits, see alignment E=7.6e-28

Best Hits

Swiss-Prot: 39% identical to CBPG_PSES6: Carboxypeptidase G2 (cpg2) from Pseudomonas sp. (strain RS-16)

KEGG orthology group: K01295, glutamate carboxypeptidase [EC: 3.4.17.11] (inferred from 97% identity to pfs:PFLU3649)

Predicted SEED Role

"Glutamate carboxypeptidase (EC 3.4.17.11)" (EC 3.4.17.11)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.17.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1T1K8 at UniProt or InterPro

Protein Sequence (409 amino acids)

>PS417_15975 glutamate carboxypeptidase (Pseudomonas simiae WCS417)
MLFNFPRTLLAATLAMSFAVPAYSAEPHKQIQAHAEQYKADALKLLERLVNIDSGSGYEP
GLTQVRDIAVDELKQLGFSIELVPDKAANNSHVVATLKGTGKAKILLMAHMDTVFKEGSA
AERPFHIKDGRAYGPGVMDDKGGIVAGIYALKVLKDQGFKDYAQITFLLDASEETGSDAA
SELIRKTAKAHDVTLNLEPGRPADGLVVWRKGSATAVVEVKGKAAHAGVAPELGRNAAME
AAHQILQLGKLGDEEKKTTINFTVIKAGDRTNVIPDQATAKADVRAALPEEFDRIEKDLA
RVSANKLIPETEVKTSLQRGLPPMPQTPESDKLVAIAQGIYGELGKKLTIEGSGGAADAS
LSAGVGTPTLDGFGIVGGNIHTPEEYAEVESVVPRVYLLSRMIMELSKR