Protein Info for GFF312 in Variovorax sp. SCN45

Annotation: FIG021862: membrane protein, exporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 780 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 241 to 260 (20 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details amino acids 309 to 327 (19 residues), see Phobius details amino acids 338 to 357 (20 residues), see Phobius details amino acids 363 to 386 (24 residues), see Phobius details amino acids 415 to 435 (21 residues), see Phobius details amino acids 636 to 655 (20 residues), see Phobius details amino acids 661 to 682 (22 residues), see Phobius details amino acids 688 to 708 (21 residues), see Phobius details amino acids 721 to 741 (21 residues), see Phobius details amino acids 753 to 772 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 90% identity to vpe:Varpa_3234)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (780 amino acids)

>GFF312 FIG021862: membrane protein, exporter (Variovorax sp. SCN45)
VLLAWLLVLVCGAVVIARTQIGADLSAFLPKSPDVRQRVLIEQLQSGVASRTLMLGIEGG
SVEQRATVSRAVAKSMRESQLFDLVQNGDVSDWSDAGTWVFEHRYQLSPGVTPGQFTVAG
LRDAINETLSMLGTPAGNVIKPLLDRDPTGETQRIAMELVPASAPRSEDGVWMSRSAPRA
LMIATTRAAGSDLDAQAVAIARVNAAYEAVARGMGADAPKLLLSGPPVFSVMSRDKIKTE
AIHLAVVGGIVMGGLLLLAFASPRALVIAFLPVATGVVVGTASVSLVFGSVHGLTLGFGS
TLIGETVDYAIYYLIQARGAAVAGTGWQRWRDLNWPTVRLGLLTSVCGFAALVFSGFPGL
AQLGVFSIAGLVSAALATRYVLPMLAPDGATGMGMRRYMAQLAGALVRGLPRLRWPLAAL
GVAALGLVLWQGGHLWRGDLGAMSPVPKAAQQMDEMLRNDIGASDGGVLVVAYGDDEQAA
LRNTEAAAARLDALVDSGELMGYETVTRVLPSLQTQAARIGGLPSGDTLRANLAEATQGM
PLPAARLEPFVKDVEAARKLQPVQRADLAGGPLGSVLNTLMYQRPGGGWGTLVVLHPGAK
FDQKRLETALAGLPEVQVVDVGRELAGLYQRYLHEAFVQVLLGALAVVVLLGIYLRSWRR
LLAVCQPLLFAVVLTLGGMAVLQAALGILHLVGLLLIVAVGSNYALFFDQLRTTGRADED
TLASLMLANLTTVVSFGLIAISDIPALSSIGRVVAPGALLALLLSAAFARSVGPSKASRG