Protein Info for GFF3116 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG00553873: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF00106: adh_short" amino acids 51 to 239 (189 residues), 155.8 bits, see alignment E=1.5e-49 PF08659: KR" amino acids 53 to 225 (173 residues), 33 bits, see alignment E=8.6e-12 PF13561: adh_short_C2" amino acids 58 to 291 (234 residues), 192.8 bits, see alignment E=1.1e-60

Best Hits

Swiss-Prot: 93% identical to YGHA_ECO57: Uncharacterized oxidoreductase YghA (yghA) from Escherichia coli O157:H7

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 99% identity to ses:SARI_04467)

MetaCyc: 93% identical to NADP+-dependent aldehyde reductase (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"FIG00553873: hypothetical protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>GFF3116 FIG00553873: hypothetical protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSHLYDPTTQYYTGEYPKQKQPAPGVQAKMTPVPDCGEKSYVGSGRLKDRKALVTGGDSG
IGRAAAIAYAREGADVAINYLPAEEEDAQQVKALIEECGRKAVLLPGDLSDESFARSLVH
KAREALGGLDILALVAGKQTAIPEIKDLTSEQFQQTFAVNVFALFWITQEAIPLLPKGAS
IITTSSIQAYQPSPHLLDYAATKAAILNYSRGLAKQVAEKGIRVNIVAPGPIWTALQISG
GQTQDKIPQFGQQTPMKRAGQPAELAPVYVYLASQESSYVTAEVHGVCGGEHLG