Protein Info for PS417_15940 in Pseudomonas simiae WCS417

Annotation: mechanosensitive ion channel protein MscS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 153 to 219 (67 residues), 69.5 bits, see alignment E=2.1e-23 PF00027: cNMP_binding" amino acids 353 to 436 (84 residues), 62.3 bits, see alignment E=3.5e-21

Best Hits

KEGG orthology group: None (inferred from 93% identity to pfs:PFLU3639)

Predicted SEED Role

"cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U2T6 at UniProt or InterPro

Protein Sequence (481 amino acids)

>PS417_15940 mechanosensitive ion channel protein MscS (Pseudomonas simiae WCS417)
MPSFIADHPMLCALALIFIDIAVWRLISVNLANWKLAARLAIFAVYSAVLFNDGMNPMQV
APYADNTALHLSATALQIGWWLFAARTLTVLLGAVMMQRVGHTGRLLQDLVGAVIFLIAI
IAAMAYVLDLPVKGVLATSGAVAIIVGLALQSTLSDVFSGIVLNTTKPYQIDDWISIDGT
EGRVTDIDWRATRLQTSQGSLAVIPNSLAAKAKIINFSRPADMFGLSVSLQVSPHARPQT
VIEALERAMQGCRPLLGNPAPSVAFKASASGGVEYEISGFVPAMSLKREVRNQLYDLAFR
HLQAAGVGLLSATESSTPPAMSAARALLERSSIFSTLRQEEKDTFSQNMTLNAYRAGEMI
LPAGEVSDHLFIVESGVVSVMLTKAGRKVEAGRMGPGEVIGEAGILSDQAALADFSAKTF
CTLYRIEKEYLKPCLDARHDISEAMKTLLDFRLHAAQALTQEAPVVPVKKGFLQWLRNRG
L