Protein Info for GFF3112 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details TIGR00645: TIGR00645 family protein" amino acids 1 to 163 (163 residues), 260.9 bits, see alignment E=3.1e-82 PF03350: UPF0114" amino acids 9 to 125 (117 residues), 126.4 bits, see alignment E=3.5e-41

Best Hits

Swiss-Prot: 100% identical to YQHA_SALSV: UPF0114 protein YqhA (yqhA) from Salmonella schwarzengrund (strain CVM19633)

KEGG orthology group: None (inferred from 99% identity to sty:STY3326)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>GFF3112 Putative membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MERFLENVMYASRWLLAPVYFGLSLALIALALKFFQEILHVLPNVFALAEADLILVLLSL
VDMTLVGGLLVMVMFSGYENFVSQLDISAGKEKLNWLGKMDATSLKNKVAASIVAISSIH
LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH