Protein Info for GFF3110 in Xanthobacter sp. DMC5

Annotation: Type II secretion system protein G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details PF07963: N_methyl" amino acids 13 to 38 (26 residues), 27.3 bits, see alignment 2.9e-10 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 18 to 38 (21 residues), 21.8 bits, see alignment (E = 1.3e-08) TIGR01710: type II secretion system protein G" amino acids 18 to 149 (132 residues), 152.9 bits, see alignment E=5e-49 PF08334: T2SSG" amino acids 41 to 148 (108 residues), 138.4 bits, see alignment E=1.4e-44

Best Hits

Swiss-Prot: 46% identical to GSPG_PSEAE: Type II secretion system protein G (xcpT) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02456, general secretion pathway protein G (inferred from 85% identity to xau:Xaut_2109)

Predicted SEED Role

"General secretion pathway protein G"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (150 amino acids)

>GFF3110 Type II secretion system protein G (Xanthobacter sp. DMC5)
MMASPVLSRSRRRRTEGGYTLVELLVVITIIGLIVALVGPRVLGYLGDSKVKTAKIQIQG
FSSALDLFYLDAGRYPSSSEGLNALVQRPGNVTTWNGPYLKGGTVPLDPWGKAYAYRSPG
QHGPFDIVSLGSDGQEGGTGTAADVTSWAR