Protein Info for GFF3107 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Fe-S-cluster-containing hydrogenase components 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 293 to 311 (19 residues), see Phobius details TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 1 to 26 (26 residues), 20.4 bits, see alignment (E = 2.5e-08) PF13247: Fer4_11" amino acids 106 to 207 (102 residues), 79.8 bits, see alignment E=5.4e-26 PF12838: Fer4_7" amino acids 111 to 159 (49 residues), 31.8 bits, see alignment 5.7e-11 PF12797: Fer4_2" amino acids 137 to 157 (21 residues), 26.5 bits, see alignment (E = 1.5e-09) PF12837: Fer4_6" amino acids 137 to 160 (24 residues), 29.1 bits, see alignment (E = 2.4e-10) PF00037: Fer4" amino acids 139 to 160 (22 residues), 25.4 bits, see alignment (E = 3.2e-09)

Best Hits

Swiss-Prot: 95% identical to HYBA_ECOLI: Hydrogenase-2 operon protein HybA (hybA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to sei:SPC_3218)

MetaCyc: 95% identical to hydrogenase 2 iron-sulfur protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Fe-S-cluster-containing hydrogenase components 1" in subsystem Anaerobic respiratory reductases or Hydrogenases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>GFF3107 Fe-S-cluster-containing hydrogenase components 1 (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VNRRDFIKAASGGALLLGAAPSVSHAAAENRPPIPGSLGMLYDSTLCVGCQACVTKCQDI
NFPARNPEGEQTWSNNDKLSPYTNNIIQVWRSGTGVNKDQEENGYAYIKKQCMHCVDPNC
VSVCPVSALKKDPKTGIVHYDKDVCTGCRYCMVACPYNVPKYDYNNPFGALHKCELCNQK
GVERLDKGGLPGCVEVCPAGAVIFGTREELMAEAKKRLALKPGSEYHYPRQTLKTDDTYL
HTVPKYYPHLYGEKEGGGTQVLVLTGVPYEDLDLPKLDDLSTGARSEHVQHTLYKGMILP
LAALAGLTVLVRRNSKNDHHDGGDDHES