Protein Info for PS417_15880 in Pseudomonas simiae WCS417

Annotation: GNAT family acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 PF00583: Acetyltransf_1" amino acids 32 to 141 (110 residues), 53.6 bits, see alignment E=6.7e-18 PF13508: Acetyltransf_7" amino acids 46 to 141 (96 residues), 44.3 bits, see alignment E=5e-15 PF08445: FR47" amino acids 73 to 142 (70 residues), 23.3 bits, see alignment E=1.3e-08 PF13673: Acetyltransf_10" amino acids 74 to 160 (87 residues), 40.2 bits, see alignment E=8.3e-14 PF13527: Acetyltransf_9" amino acids 88 to 143 (56 residues), 35.1 bits, see alignment E=3e-12

Best Hits

KEGG orthology group: None (inferred from 91% identity to pfs:PFLU3628)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U7W2 at UniProt or InterPro

Protein Sequence (163 amino acids)

>PS417_15880 GNAT family acetyltransferase (Pseudomonas simiae WCS417)
MPALTFRTALPADAARCFDIEISAYEGDEAATLEKIATRIAQYPQGFLILEAEGEVVGFI
NCGCAHEVVMSDEAFKELVGHCAEAPNVVIMSVVVDPAHQGKGYSKALMTEFVQRMRGMG
KQTIHLMCKEQHVPLYERMGYDYVRPSPSDHGGMAWHEMVRAL