Protein Info for GFF3102 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Phosphoglycolate phosphatase (EC 3.1.3.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF00702: Hydrolase" amino acids 24 to 206 (183 residues), 113.3 bits, see alignment E=3.9e-36 PF12710: HAD" amino acids 27 to 202 (176 residues), 27.8 bits, see alignment E=6.3e-10 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 28 to 239 (212 residues), 204.2 bits, see alignment E=2.8e-64 PF13419: HAD_2" amino acids 28 to 212 (185 residues), 103.7 bits, see alignment E=2.5e-33 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 89 to 206 (118 residues), 39.8 bits, see alignment E=8.9e-14 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 91 to 212 (122 residues), 40.5 bits, see alignment E=4.6e-14 PF13242: Hydrolase_like" amino acids 168 to 235 (68 residues), 42.9 bits, see alignment E=7.7e-15

Best Hits

Swiss-Prot: 42% identical to GPH_RHORT: Phosphoglycolate phosphatase (cbbZ) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 69% identity to del:DelCs14_5795)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>GFF3102 Phosphoglycolate phosphatase (EC 3.1.3.18) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPWPDLAHLKVHSVNLTPSSPQGIRAAIVDLDGTMVDTLGDFDVALNAALKDVHRPTVAR
ADIEHMVGKGSAHLIRSALLHGGLGADDAARVQPEVWTRYQSHYLAINGQHSTVYPGVVE
GLTALRAQGWSLACLTNKPLNFARPLLQAKGLADFFAHVFGGDSFERTKPDPLPLLKTCE
ALGTAPAQTLMVGDSQNDALAARAAGCPVVLVTYGYNHGEPVRGVDADAFVDRLDHLPGL
RQAGA