Protein Info for PS417_01580 in Pseudomonas simiae WCS417
Annotation: imidazole glycerol phosphate synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to HIS6_PSEFS: Imidazole glycerol phosphate synthase subunit HisF (hisF) from Pseudomonas fluorescens (strain SBW25)
KEGG orthology group: K02500, cyclase [EC: 4.1.3.-] (inferred from 99% identity to pfs:PFLU0331)MetaCyc: 53% identical to imidazole-glycerol-phosphate synthase cycloligase subunit (Thermotoga maritima)
GLUTAMIDOTRANS-RXN [EC: 4.3.2.10]
Predicted SEED Role
"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
- L-histidine biosynthesis (10/10 steps found)
- L-citrulline biosynthesis (8/8 steps found)
- superpathway of L-citrulline metabolism (10/12 steps found)
- L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
- glutaminyl-tRNAgln biosynthesis via transamidation (4/4 steps found)
- L-glutamate and L-glutamine biosynthesis (6/7 steps found)
- ammonia assimilation cycle III (3/3 steps found)
- L-glutamate biosynthesis I (2/2 steps found)
- L-glutamine degradation I (1/1 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of plant hormones
- Pyruvate metabolism
Isozymes
Compare fitness of predicted isozymes for: 4.1.3.-
Use Curated BLAST to search for 4.1.3.- or 4.3.2.10
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7UBG7 at UniProt or InterPro
Protein Sequence (256 amino acids)
>PS417_01580 imidazole glycerol phosphate synthase (Pseudomonas simiae WCS417) MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGR DTTLHTVERMASQVFIPLTVGGGVRTVQDIRNLLNAGADKVSINTAAVFNPEFVGEAAQH FGSQCIVVAIDAKKVSGPGETPRWEIFTHGGRKPTGLDAVEWAVKMEGLGAGEILLTSMD QDGMKNGFDLGVTRAISDALGIPVIASGGVGNLQHLADGVTEGHASAVLAASIFHFGEYT VPEAKAYMAARGIVVR