Protein Info for GFF31 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Hydroxymethylpyrimidine ABC transporter, transmembrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 58 to 82 (25 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 121 to 144 (24 residues), see Phobius details amino acids 176 to 201 (26 residues), see Phobius details amino acids 224 to 249 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 73 to 244 (172 residues), 86.7 bits, see alignment E=8.4e-29

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 61% identity to bxe:Bxe_C0801)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>GFF31 Hydroxymethylpyrimidine ABC transporter, transmembrane component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPSKRHLQLLLPIGLGIAVLLLWEFLTRAVPISEHLLPGPLRIGRALQEDWGLLNSALWV
TLRITAIAFVAAVLGASLMAIFFSSSRWIEMTLYPYAVILQVTPVVAIAPLLIIWIDNTA
FALLACAWLIAFFPILSNTVVGLASADHNLRDLFQLYGASPMQTLWGLRIPSAMPYFLAG
VRISGGLSLIGAIVAEFVAGAGGEGSGLAYRILEAGYQLKTPRMFAALLLISLTGVGIFL
ITSTISRLVLSRWHESAVEREQ