Protein Info for GFF3099 in Hydrogenophaga sp. GW460-11-11-14-LB1
Annotation: Citrate synthase (si) (EC 2.3.3.1)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01647, citrate synthase [EC: 2.3.3.1] (inferred from 57% identity to bja:bll6374)Predicted SEED Role
"Citrate synthase (si) (EC 2.3.3.1)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 2.3.3.1)
MetaCyc Pathways
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
- glyoxylate cycle (6/6 steps found)
- TCA cycle IV (2-oxoglutarate decarboxylase) (8/9 steps found)
- TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
- superpathway of glyoxylate bypass and TCA (10/12 steps found)
- partial TCA cycle (obligate autotrophs) (7/8 steps found)
- ethene biosynthesis V (engineered) (19/25 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
- TCA cycle I (prokaryotic) (8/10 steps found)
- TCA cycle II (plants and fungi) (7/9 steps found)
- nitrogen remobilization from senescing leaves (6/8 steps found)
- TCA cycle III (animals) (7/10 steps found)
- TCA cycle VI (Helicobacter) (6/9 steps found)
- TCA cycle VII (acetate-producers) (6/9 steps found)
- mixed acid fermentation (11/16 steps found)
- methylaspartate cycle (12/19 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Citrate cycle (TCA cycle)
- Glyoxylate and dicarboxylate metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.3.3.1
Use Curated BLAST to search for 2.3.3.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (260 amino acids)
>GFF3099 Citrate synthase (si) (EC 2.3.3.1) (Hydrogenophaga sp. GW460-11-11-14-LB1) MAQRKPMRTDIAWSTTDSITVKGLDVCKDILGKVSLGDMAFLEMTDRLPTPRESVVFNAI AVCLVEHGLTPSALATRLTIAGAPEAMQAAVGAGLCGLGSVFVGSMEDAARLLQRAMPQP DPAADIAALAAALVDRELAAGRSIPGIGHHIHKPVDPRAPALFAIARENGFAGPYVELMN AVATEAGRRLGKNLPVNATGAIAAIASELRLPWEIVRGIGVMARAIGLVAHVLEELRNPL AREMKTLVEDMATAHFRTAP