Protein Info for GFF3092 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Hexuronate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 46 to 65 (20 residues), see Phobius details amino acids 75 to 103 (29 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details amino acids 270 to 294 (25 residues), see Phobius details amino acids 306 to 324 (19 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details amino acids 363 to 391 (29 residues), see Phobius details amino acids 396 to 415 (20 residues), see Phobius details PF07690: MFS_1" amino acids 15 to 291 (277 residues), 156.8 bits, see alignment E=7.1e-50 amino acids 303 to 428 (126 residues), 41.4 bits, see alignment E=8.8e-15 PF00083: Sugar_tr" amino acids 42 to 193 (152 residues), 29.5 bits, see alignment E=3.6e-11

Best Hits

Swiss-Prot: 48% identical to EXUT_ECOLI: Hexuronate transporter (exuT) from Escherichia coli (strain K12)

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 100% identity to sei:SPC_3202)

MetaCyc: 48% identical to hexuronate transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-123; TRANS-RXN-35

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>GFF3092 Hexuronate transporter (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKMTKLRWWIIGLVCVGTIVNYLSRSSLSVAAPAMMKELHFDEQQYSWVVSAFQLCYTIA
QPITGYLMDVIGLKIGFFIFALLWSLINMAHALAGGWISLAFLRGLMGLTEASAIPAGIK
ASAEWFPTKERGIAGGLFNIGTSIGAMLAPPLVVWAMLTFADSGIGTEMAFVITGGIGVL
FAITWFLIYNSPNKHPWITHKELRYIEDGQESYLQDDNKKPAVKEIVKKRNFWALAITRF
LADPAWGTLSFWMPLYLINVMHLPLKEIAMFAWLPFLAADFGCVAGGFLAKFFMEKMHMT
TINARRCSFTIGAVLMISIGFVSITTNPYVAIALMSIGGFAHQTLSTVVITMSADLFKKN
EVATVAGLAGSAAWMGQLSFNLFMGALVAIIGYGPFFIALSLFDIIGAIILWVLIKDPEK
HHPPMTEQPLASHR