Protein Info for GFF3091 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: C-terminal domain of CinA type S; Protein Implicated in DNA repair function with RecA and MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02464: CinA
  • amino acids 7 to 158 (152 residues), 201.6 bits, E=2.8e-64
• TIGR00199: amidohydrolase, PncC family
  • amino acids 12 to 159 (148 residues), 163.2 bits, E=2.3e-52

Best Hits

Swiss-Prot: 62% identical to PNCC_ENTAG: Nicotinamide-nucleotide amidohydrolase PncC (pncC) from Enterobacter agglomerans

KEGG orthology group: K03743, (no description) (inferred from 72% identity to vap:Vapar_0483)

MetaCyc: 57% identical to NMN aminohydrolase (Escherichia coli K-12 substr. MG1655)
Nicotinamide-nucleotide amidase. [EC: 3.5.1.42]

Predicted SEED Role

No annotation

MetaCyc Pathways

• NAD salvage pathway II (PNC IV cycle) (5/5 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.42

Protein Sequence (160 amino acids)

>GFF3091 C-terminal domain of CinA type S; Protein Implicated in DNA repair function with RecA and MutS (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPDTTATLVEQLAHALKARGLMMATAESCTGGLIAGACTDVSGSSDWFERGFVTYSNAAK
HGMLGVPALLIEQHGAVSEPVARAMASGALAHSPAQLAVAVTGVAGPTGGSAEKPVGTVW
FGWATPEGVFTEHQRFDGDRAAVRQATVRHALAGLLQRLT