Protein Info for GFF309 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative transcriptional regulator of unknown carbohydrate utilization cluster, GntR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF00392: GntR" amino acids 12 to 75 (64 residues), 60.6 bits, see alignment E=9.4e-21 PF07702: UTRA" amino acids 98 to 236 (139 residues), 95.1 bits, see alignment E=3.5e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to sec:SC3706)

Predicted SEED Role

"Putative transcriptional regulator of unknown carbohydrate utilization cluster, GntR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>GFF309 Putative transcriptional regulator of unknown carbohydrate utilization cluster, GntR family (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKTLSKSSHIPLYQQVVEWIRESIYSGELVEDDRIPSEFQIMDMLEVSRGTVKKAVDQLV
REGVLVQVQGKGTFVKKENVAYPLGEGLLSFAEALASQKINFTTSVITSRLEPANRFVAE
KLSIKPGQDVLFLKRLRCIGDEKVMLIENRINIDLCPGIIDVDFTRENLFSAIERLSDKK
ISFSESRYAAKLIGNERGHYLDIGEDAPVLHLEQLVFFSRGLAIDFGNVWLKGNKYYLGT
ILQRLDA