Protein Info for GFF3078 in Xanthobacter sp. DMC5

Annotation: ECF RNA polymerase sigma factor RpoE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 31 to 187 (157 residues), 87.6 bits, see alignment E=3.7e-29 PF04542: Sigma70_r2" amino acids 36 to 103 (68 residues), 60.7 bits, see alignment E=1.4e-20 PF08281: Sigma70_r4_2" amino acids 134 to 185 (52 residues), 49.3 bits, see alignment E=4.5e-17 PF04545: Sigma70_r4" amino acids 138 to 187 (50 residues), 51.5 bits, see alignment E=8.6e-18

Best Hits

Swiss-Prot: 30% identical to SIGL_MYCTE: ECF RNA polymerase sigma factor SigL (sigL) from Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 54% identity to azl:AZL_d01850)

Predicted SEED Role

"RNA polymerase sigma-70 factor" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>GFF3078 ECF RNA polymerase sigma factor RpoE (Xanthobacter sp. DMC5)
MSVQPAEPRVAASGAELSALIVAIATRADREAFGRLFRHFAPRVKSYLVRNGLSANAAEE
LAQETLLTVWRKAAYFDPTRAAASTWIFTIARNLSIDLKRRERYGDTYQAEAHEDEVDET
SGETILMTAEREARVRAALAKLSEEQATIVRLSFFQEKPHSQIAQELGIPLGTAKSRVRL
ALNRLRALLEDLK