Protein Info for GFF3076 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: LysR family transcriptional regulator STM3121

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF00126: HTH_1" amino acids 3 to 62 (60 residues), 81.6 bits, see alignment E=3.1e-27 PF03466: LysR_substrate" amino acids 87 to 287 (201 residues), 158.7 bits, see alignment E=1.4e-50

Best Hits

Swiss-Prot: 42% identical to BUDR_RAOTE: HTH-type transcriptional regulator BudR (budR) from Raoultella terrigena

KEGG orthology group: None (inferred from 99% identity to sew:SeSA_A3296)

Predicted SEED Role

"LysR family transcriptional regulator STM3121" in subsystem DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>GFF3076 LysR family transcriptional regulator STM3121 (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MELRHIRYFLAVAEERHFTRAATKLGIGQPPLSQQIKDLERELGAQLFRRVPHGAELTEA
GKAFYDVVKGMPATATRAVLAAQRVARGESGVLRVGFTASAAFNSVVPGAIRTFKRAYPD
VRLQLEEGNTTQLADELNEGSLDVAFLRPGFTGNERFQLRLLSEEPMVIVLAETHPAAAC
KQIALSILKDEFFLLFPREIGLSLYDAVIKACGKAGFEPKIGQLVPQISSVINLVSAEMG
VSMVPDSMRQVNVKGVVYRPVADQMPVAKLALAYRRGDTSPTLRNFILKVTG