Protein Info for GFF3073 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 51 to 76 (26 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 136 to 152 (17 residues), see Phobius details PF08592: Anthrone_oxy" amino acids 57 to 147 (91 residues), 67 bits, see alignment E=7.9e-23

Best Hits

KEGG orthology group: None (inferred from 66% identity to pol:Bpro_1649)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>GFF3073 Integral membrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
VSGTDLLALLTALGAATVGGVFFGFSTFVMKALAQLPAAQGVAAMQRINIVVINPWFMGA
FMGTLLLSIACVVVAWMSASAALLAAGLLYAVGTFGVTMAFNVPRNNRLARLDAASDEAA
AYWPVYVREWTRWNHVRTGAALAAAACGVLVWSN