Protein Info for GFF3072 in Pseudomonas sp. DMC3

Annotation: Phosphoribosyl-ATP pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03188: phosphoribosyl-ATP diphosphatase
  • amino acids 5 to 92 (88 residues), 95.9 bits, E=6.7e-32
• PF01503: PRA-PH
  • amino acids 6 to 95 (90 residues), 58.8 bits, E=2.9e-20

Best Hits

Swiss-Prot: 99% identical to HIS2_PSEPF: Phosphoribosyl-ATP pyrophosphatase (hisE) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01523, phosphoribosyl-ATP pyrophosphohydrolase [EC: 3.6.1.31] (inferred from 99% identity to pba:PSEBR_a399)

Predicted SEED Role

"Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.6.1.31)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.31

Protein Sequence (110 amino acids)

>GFF3072 Phosphoribosyl-ATP pyrophosphatase (Pseudomonas sp. DMC3)
MSDTLTRLAQVLEERKGAAADSSYVASLYHKGLNKILEKVGEESVETIIAAKDAAISGDC
SDVIYETADLWFHSMVMLAQLGQHPQAVLDELDRRFGLSGHVEKASRPSA