Protein Info for GFF3069 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Nucleoside permease NupG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 250 to 275 (26 residues), see Phobius details amino acids 282 to 300 (19 residues), see Phobius details amino acids 306 to 327 (22 residues), see Phobius details amino acids 347 to 366 (20 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details TIGR00889: nucleoside transporter" amino acids 1 to 418 (418 residues), 720.2 bits, see alignment E=4.4e-221 PF03825: Nuc_H_symport" amino acids 1 to 406 (406 residues), 606.5 bits, see alignment E=3.6e-186 PF12832: MFS_1_like" amino acids 6 to 371 (366 residues), 91 bits, see alignment E=1.3e-29 PF07690: MFS_1" amino acids 252 to 405 (154 residues), 44.5 bits, see alignment E=1.5e-15

Best Hits

Swiss-Prot: 91% identical to NUPG_ECOLI: Nucleoside permease NupG (nupG) from Escherichia coli (strain K12)

KEGG orthology group: K03289, MFS transporter, NHS family, nucleoside permease (inferred from 100% identity to sei:SPC_3180)

MetaCyc: 91% identical to nucleoside:H+ symporter NupG (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-108A; TRANS-RXN-108B; TRANS-RXN-108C; TRANS-RXN-108D; TRANS-RXN-108E; TRANS-RXN-108G; TRANS-RXN-108H; TRANS-RXN-108I; TRANS-RXN-474; TRANS-RXN-475; TRANS-RXN-476

Predicted SEED Role

"Nucleoside permease NupG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>GFF3069 Nucleoside permease NupG (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNLKLQLKILSFLQFCLWGSWLTTLGSYMFVTLKFDGASIGAVYSSLGIAAVFMPTLLGI
VADKWLSAKWVYALCHVVGAITLFMAAEVTTPGAMFFVILLNSLAYMPTLGLINTISYYR
LQSAGMDIVTDFPPIRIWGTIGFILAMWGVSFSGFELSHMQLYIGATLSVLLVLFTFTLP
HIPVANQQKNQSWTSMLGLDAFALFKNKRMAIFFIFSMMLGAELQITNMFGNTFLHSFDK
DPLFASSFIVQHASVMMSISQISETLFILTIPFFLSRYGIKNVMLISIVAWMLRFGLFAY
GDPTPFGTVLLVLSMIVYGCAFDFFNISGSVFVEKEVRPEIRASAQGMFLMMTNGFGCIL
GGIVSGKVVEYYTQNGITDWQTVWLIFAGYSLVLAFAFVALFKYKHVRVPASSQPVAH