Protein Info for PS417_15695 in Pseudomonas simiae WCS417

Annotation: molybdenum cofactor biosynthesis protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 3 to 328 (326 residues), 359.9 bits, see alignment E=5.9e-112 PF04055: Radical_SAM" amino acids 17 to 176 (160 residues), 122.3 bits, see alignment E=3.6e-39 PF13353: Fer4_12" amino acids 20 to 120 (101 residues), 27.7 bits, see alignment E=4.6e-10 PF06463: Mob_synth_C" amino acids 182 to 310 (129 residues), 115.2 bits, see alignment E=3.1e-37

Best Hits

Swiss-Prot: 74% identical to MOAA1_PSEAE: GTP 3',8-cyclase 1 (moaA1) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 82% identity to pba:PSEBR_a3143)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TE75 at UniProt or InterPro

Protein Sequence (328 amino acids)

>PS417_15695 molybdenum cofactor biosynthesis protein A (Pseudomonas simiae WCS417)
MSLVDGLGRSIDYLRLSVTDRCDFRCVYCMAKTMTFLPRQQVLSLQELERLARLFVGQGV
RKIRLTGGEPLIRPGIVGLCRTIAALPGLRELVMTSNGSQLARLAQPLAAAGVKRMNISL
DSLDPVRFRAITRNGDLRQVQEGIEAARDAGFERVKLNCVVMKGRNFDEVPALVRYAIEQ
GIDISFIEEMPLGDVGRSRGETFCASDEVREVIAREHLLLDTAESSGGPARYVRLARYPD
TRIGFISPNSQSFCGSCNRLRMTVEGRLLLCLGQDDALDFRELLRRSPLDDRPLVEALHR
ALRGKPARHDFSGAGEVQVVRFMSMSGG