Protein Info for GFF3066 in Variovorax sp. SCN45

Annotation: Nitrogen regulation protein NR(I), GlnG (=NtrC)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 PF00072: Response_reg" amino acids 4 to 119 (116 residues), 83.8 bits, see alignment E=2.9e-27 TIGR01818: nitrogen regulation protein NR(I)" amino acids 4 to 399 (396 residues), 621.9 bits, see alignment E=3.5e-191 PF14532: Sigma54_activ_2" amino acids 143 to 313 (171 residues), 72.7 bits, see alignment E=1.1e-23 PF00158: Sigma54_activat" amino acids 143 to 308 (166 residues), 236.7 bits, see alignment E=3.5e-74 PF07728: AAA_5" amino acids 166 to 284 (119 residues), 37 bits, see alignment E=9.8e-13 PF25601: AAA_lid_14" amino acids 314 to 394 (81 residues), 84.5 bits, see alignment E=1.1e-27 PF02954: HTH_8" amino acids 469 to 507 (39 residues), 40.8 bits, see alignment 4.5e-14

Best Hits

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 92% identity to vap:Vapar_1635)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>GFF3066 Nitrogen regulation protein NR(I), GlnG (=NtrC) (Variovorax sp. SCN45)
MKPIWIVDDDQSIRFVLEKALLREDLPTRSFTNTREVLAALEQAADDEQQGPQVLVSDIR
MPGGSGLDLLDKIKAKHPGLPVIIMTAFSDLDSAVSAFQGGAFEYLPKPFDLPRAVELIR
RAVDESQREEVAEERMVAAPEMLGQAPAMQDVFRAIGRLSQSNVTVLITGESGSGKELVA
RALHKHSPRANGPFVAINTAAIPKDLLESELFGHERGAFTGAQTMRRGRFEQAEGGTLFL
DEIGDMPFDLQTRLLRVLSDGHFYRVGGHNSVKANVRVIAATHQDLEQRVKLGGFREDLF
HRLNVIRLRLPALRERGEDVPALTRHFLQMSARQLGVEPKRISDAALTKLAAFSFPGNVR
QLENICHWLTVMAPAQLIEAKDLPPEVMAVGTAAAEVHSAEAAPNAVATASPLAPPLSVT
TGDAPAVAPVHSEAAESSALVSSWESGLEVEAQALLAAGRTDVWDVLSRRFESRLILTAL
ANTRGRRIEAAQKLGIGRNTITRKIQELGIE