Protein Info for GFF3061 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG00931323: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 23 to 23 (1 residues), see Phobius details amino acids 38 to 62 (25 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details PF01810: LysE" amino acids 17 to 206 (190 residues), 96.5 bits, see alignment E=7.5e-32

Best Hits

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 66% identity to pol:Bpro_4492)

Predicted SEED Role

"FIG00931323: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>GFF3061 FIG00931323: hypothetical protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTLAFPTFTAGMVLSMSLIMAIGPQNAHVLRMGLQRQHLWLTVLTCALADVVLIGLGVLG
LAQLGGLSDKLLGAMIGAGVLFLAVYGWQAFQRFLRPRANPLSADGSPAAEPVSPRQAVF
AALAFSFLNPHAWLDTAVLIGTASLAYGQGSAVFGLGAATGSLVWFVSLGAAAFWLGRRL
NSLHVWRVLDGLVALMMWGTAGWLLTSLF