Protein Info for GFF3060 in Xanthobacter sp. DMC5

Annotation: Ribose-5-phosphate isomerase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 TIGR00021: ribose 5-phosphate isomerase A" amino acids 8 to 227 (220 residues), 249.3 bits, see alignment E=1.3e-78 PF06026: Rib_5-P_isom_A" amino acids 52 to 226 (175 residues), 197.7 bits, see alignment E=5.8e-63

Best Hits

Swiss-Prot: 64% identical to RPIA_OLICO: Ribose-5-phosphate isomerase A (rpiA) from Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)

KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 87% identity to xau:Xaut_3221)

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>GFF3060 Ribose-5-phosphate isomerase A (Xanthobacter sp. DMC5)
MVHAEDLKRRAAAHALTYVTDGMRLGLGTGSTARHFVELLAEKVHGGLTVLGVPTSEQTL
AQAVSLGVPIATLDEAGPLDLCIDGADEIGPGLALIKGGGGALLREKIVASAAREMIVIA
DATKKVDVLGRFPLPIEVVDFGVAAITRQVVEAIRSAGCAGDITVRRDGDGHPFVTDQGH
LILDAHLGRIPDPAALAAAVAQVAGVVEHGLFIGLARRAVLAGKDGITELEPGSF