Protein Info for GFF3060 in Xanthobacter sp. DMC5

Annotation: Ribose-5-phosphate isomerase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00021: ribose 5-phosphate isomerase A
  • amino acids 8 to 227 (220 residues), 249.3 bits, E=1.3e-78
• PF06026: Rib_5-P_isom_A
  • amino acids 52 to 226 (175 residues), 197.7 bits, E=5.8e-63

Best Hits

Swiss-Prot: 64% identical to RPIA_OLICO: Ribose-5-phosphate isomerase A (rpiA) from Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)

KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 87% identity to xau:Xaut_3221)

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

• Rubisco shunt (10/10 steps found)
• Calvin-Benson-Bassham cycle (12/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• Bifidobacterium shunt (13/15 steps found)
• ethene biosynthesis V (engineered) (20/25 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• pentose phosphate pathway (7/8 steps found)
• oxygenic photosynthesis (13/17 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Protein Sequence (235 amino acids)

>GFF3060 Ribose-5-phosphate isomerase A (Xanthobacter sp. DMC5)
MVHAEDLKRRAAAHALTYVTDGMRLGLGTGSTARHFVELLAEKVHGGLTVLGVPTSEQTL
AQAVSLGVPIATLDEAGPLDLCIDGADEIGPGLALIKGGGGALLREKIVASAAREMIVIA
DATKKVDVLGRFPLPIEVVDFGVAAITRQVVEAIRSAGCAGDITVRRDGDGHPFVTDQGH
LILDAHLGRIPDPAALAAAVAQVAGVVEHGLFIGLARRAVLAGKDGITELEPGSF