Protein Info for PS417_01560 in Pseudomonas simiae WCS417

Annotation: imidazoleglycerol-phosphate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00475: IGPD
  • amino acids 34 to 176 (143 residues), 213.2 bits, E=8.3e-68

Best Hits

Swiss-Prot: 100% identical to HIS7_PSEFS: Imidazoleglycerol-phosphate dehydratase (hisB) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K01693, imidazoleglycerol-phosphate dehydratase [EC: 4.2.1.19] (inferred from 100% identity to pfs:PFLU0327)

Predicted SEED Role

"Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19)" in subsystem Histidine Biosynthesis (EC 4.2.1.19)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.19

Sequence Analysis Tools

See A0A1N7UEK1 at UniProt or InterPro

Protein Sequence (197 amino acids)

>PS417_01560 imidazoleglycerol-phosphate dehydratase (Pseudomonas simiae WCS417)
MAERKASVERDTLETQIKASINLDGTGKARFDIGVPFLEHMLDQIARHGLIDLDIVSKGD
LHIDDHHTVEDVGITLGQAFAKAIGDKKGIRRYGHAYVPLDEALSRVVIDFSGRPGLQMH
VPYTRATVGGFDVDLFQEFFQGFVNHALVSLHIDNLRGTNTHHQIETVFKAFGRALRMAV
ELDDRMAGQMPSTKGVL