Protein Info for GFF3050 in Variovorax sp. SCN45

Annotation: Lactam utilization protein LamB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03746: LamB_YcsF
  • amino acids 3 to 239 (237 residues), 313 bits, E=7.2e-98

Best Hits

Swiss-Prot: 67% identical to PXPA1_PSESM: 5-oxoprolinase subunit A 1 (pxpA1) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K07160, UPF0271 protein (inferred from 91% identity to vap:Vapar_6367)

MetaCyc: 43% identical to 5-oxoprolinase component A (Escherichia coli K-12 substr. MG1655)
5-oxoprolinase (ATP-hydrolyzing). [EC: 3.5.2.9]

Predicted SEED Role

"Lactam utilization protein LamB"

MetaCyc Pathways

• 5-oxo-L-proline metabolism (5/6 steps found)
• γ-glutamyl cycle (4/6 steps found)

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.9

Protein Sequence (254 amino acids)

>GFF3050 Lactam utilization protein LamB (Variovorax sp. SCN45)
MDIDLNADLGEGFGPWRMGEDEALLDIVSSANVACGFHAGDPVIMDRTVRMARQRGVDVG
AHVGFPDLMGFGRRQMQIETKELVSYVLYQLSALAGMARTAGHRMTHMSFHGALGNMAAA
DAALAEPLVRAVADFDPSLTVSTSASRAIEGAAERCGLRVRTTFLADRACGDDGLLVPRK
LPGAVIHEREAVLARVRQLLEDGTVTSSTGKKIPMRVHSILLHGDTPGAVELARAVRGVV
EQAGRIVPISRQSN