Protein Info for GFF3035 in Variovorax sp. SCN45

Annotation: Ferrichrome-iron receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 731 PF07715: Plug" amino acids 92 to 193 (102 residues), 54.8 bits, see alignment E=1.2e-18 TIGR01783: TonB-dependent siderophore receptor" amino acids 94 to 731 (638 residues), 323 bits, see alignment E=2.3e-100 PF00593: TonB_dep_Rec" amino acids 286 to 701 (416 residues), 146.7 bits, see alignment E=2e-46

Best Hits

KEGG orthology group: None (inferred from 62% identity to axy:AXYL_05378)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (731 amino acids)

>GFF3035 Ferrichrome-iron receptor (Variovorax sp. SCN45)
LNPRRQNAADANPSAISFRRAAFGPHARATLLVLWAATQGGRALAQDAQQANPARDSAAL
PTVTVTADAQQDDTPQHLNAKAGAGALGTRSQLETPFSTTVVRSEDIAERQVSKLGDVFA
LDASVSDNSGAYSSWATYISVRGLPLDWQNGYRINGQPFLSYAITLPYEQFEQIDLLKGS
SGFMYGFGSPGGIVNYVTKKPTDQPVRSIDVGYKTAGVWSEHVDLGGRFGADDRFGYRLN
ATHEEGKTYNDGNVRRNSVSLGLDAKLTDKLTWTFDSLYQKRQTTGQTPSIYLGSYTGTQ
LPSTIGANNQNLVGAGQHLSTDFNLYSTGLQYQLSPDWTLSTSYSHSSATRSRNEGIAYL
LDSTGNYDDYRSDSAEGHRFNQWQAMATGKLRTGDYEHQLTLGASWQKQVNDYSSNAVYQ
LIGTGSIFSQNTNGYTSVTGFTPYRNSDITQRALFASDTLKLSDRWSVLAGLRSTTYEQN
GYDTTGTQTSTYRKSGVVTPTLALMFKPAPDTTLYGSYVESLEPGSTVSNLYANDGQLLN
PLKSRQYELGLKTERERWSATAALFRIERGAEYANSANVLVQDGLSIYQGVEFGASTRLG
SQWQVGGNLMLLDASYQRGSSYNGNRVAGAPKMIATAQVGYDVAQVPGLKLSADMKYTGG
TMLDASNQISLPGYTIANIGASYTTRIGGRNTTFRAAINNVTNRRYWEFQYDNYIKPGDP
RTFSLSAKLDF