Protein Info for GFF3035 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Acyltransferase 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 235 to 251 (17 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details amino acids 322 to 343 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 14 to 331 (318 residues), 69.9 bits, see alignment E=1e-23

Best Hits

KEGG orthology group: None (inferred from 44% identity to dar:Daro_0178)

Predicted SEED Role

"Acyltransferase 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>GFF3035 Acyltransferase 3 (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKAADSMDTGRLMFIDLLKAVGSQLIVLHHLAFYGPMSDWTHRLAPELVTWFSQDARMAV
QVFLVVAGFLAARSLAPGGVLRAPSPLGQLGQRYVRTALPYIASLLVAMLCTELARLWMA
HDSISAPPGLWQFISHALLLHTLLDVDSLSAGVWYVAIDFQLYALLLGLLWLARRRSAVG
AWAQALVVVVVAASLLHFNRDSDWDSWALYFFGAYGLGALTWWATHSDDAWRSGRWLLGA
LVALTLLALAIDFRERIALALAVCLALACSQRQGWLFTWPRSRVVAYLSRISYSVFLLNF
PIALVVNALFTRYGSADETVQTVGVLLAWLACNVAGALFHHGVEQPLGRIGRRREPALAG
TTLSAR