Protein Info for GFF3033 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 transmembrane" amino acids 153 to 178 (26 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 305 to 328 (24 residues), see Phobius details amino acids 334 to 353 (20 residues), see Phobius details PF07695: 7TMR-DISM_7TM" amino acids 166 to 352 (187 residues), 42.1 bits, see alignment E=1e-14 PF02518: HATPase_c" amino acids 504 to 590 (87 residues), 44.8 bits, see alignment E=1.5e-15

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (600 amino acids)

>GFF3033 hypothetical protein (Variovorax sp. SCN45)
VSALRTAAGIQSPAALPETGWEPVSLPHHWEREWPEFEGTVWYRIDWTRTCAEDSDNASG
AAPLAVALDYINMAGAVFANQTLLWRDPSLVEPLSRGWNTPRLLVLPDAALRPGRNALFI
QVVGASRYDSGLGNTLVADIDTATTHQQRQNFFFRTLSIVNLVISATLGVFFLAVWLVRR
KDAAYGWYALTSATWVLFFSNTVVTTPWPFGTTEGWSRFVTVAMTLFCSALYMFLWSFGG
QRFPRLARVLWAGCGLVALLFLLMPRGWYSTATMAVFIGYVLLFISACLQFIVRAVFRTR
ETEHLLLAVCLVGFLIAAIHDTLGLLGLASNTSVLTPVTAPLITIGMALILASRFARSVQ
QAESFNAVLEGQIRIARDDLARTLTREHRLELDNVRLSERLQLAHDLHDGLGSSLVRSIA
LVEQSGSAIGSRQYLSMFKSLRDDLRQVIDTSSSASATVADTPLLWLAPIRYRFGQLFDE
LEIENEWRIPPAWASPPSTKQLLGLTRILEEALTNVIKHSRATRLRVSLSTQAGGETRLS
VEDNGLGFDAAMVSESMLGIGLRSMQARASRIGGELRISSSREGSCIEARIGGGSAAPAV