Protein Info for GFF3028 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Tricarboxylate transport sensor protein TctE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 179 to 197 (19 residues), see Phobius details PF08521: 2CSK_N" amino acids 24 to 168 (145 residues), 125.9 bits, see alignment E=3.3e-40 PF26769: HAMP_PhoQ" amino acids 197 to 243 (47 residues), 40.8 bits, see alignment 4.4e-14 PF00512: HisKA" amino acids 247 to 310 (64 residues), 48.5 bits, see alignment E=1.8e-16 PF02518: HATPase_c" amino acids 356 to 471 (116 residues), 78.2 bits, see alignment E=1.6e-25

Best Hits

KEGG orthology group: K07649, two-component system, OmpR family, sensor histidine kinase TctE [EC: 2.7.13.3] (inferred from 45% identity to adk:Alide2_2489)

Predicted SEED Role

"Tricarboxylate transport sensor protein TctE"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>GFF3028 Tricarboxylate transport sensor protein TctE (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKRPGWPLVSIRRLLLILLLPGMLAVGAAELWLSWRTVNDAADAAYDRSLLGAVKSIDSS
ISTASGGLGVELPYRMLEFFELTAQGQVFYRVATEDGLVEIGSPDLPLPPRPLETGRPQF
HEGAYFGQAVRVGSYARELSEPLAGKAGPQRIVIQVAETLDARNDFRRGLLLRTVARDLL
LMLLATGLLIASITWAMRPLARFRQEVEGRPPEDLTPMATDRVPAEVLPLVHAINHHIER
NREQGEARRRFVDDASHQLRTPLATLATQVAYAQRENDPRGQREALESIRQQLEQTIQQT
NQLLAMARADGAPLVFQSLDVVRLAESATRQAWAAAREQSVDLGFDGPDQAIPLRGDPDL
IGEALSNLLVNAIRHGGAGCRATLSVRALPASNEAPAQVRLRVVDDGPGLSPEDLARAGE
RFFRGRGTEVPGSGLGLAFVRTVAHRHGGHMVVSQGPGGRGLQVDMHLPLTPT