Protein Info for GFF3025 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Multidrug resistance protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 291 to 313 (23 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details amino acids 358 to 376 (19 residues), see Phobius details amino acids 383 to 406 (24 residues), see Phobius details amino acids 425 to 446 (22 residues), see Phobius details amino acids 473 to 491 (19 residues), see Phobius details PF07690: MFS_1" amino acids 29 to 437 (409 residues), 164.1 bits, see alignment E=4.6e-52

Best Hits

KEGG orthology group: None (inferred from 63% identity to rfr:Rfer_0907)

Predicted SEED Role

"Multidrug resistance protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (501 amino acids)

>GFF3025 Multidrug resistance protein B (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTAPHPHSLPALRERYGERYRWLLLLSVMVGTMAAIMSSTIINVAIPDMSHHFALGQERA
QWVTSGFMVAMTVSMLTTPWMLARYGYRRTYVGCMWLLMAGGLAGGFASTYPLVLAARVA
EGLAAGVVQTIPAIIILRAFAPNEQGRASGIFGMGVVLAPAVGPSIGGLLVDGFGWRSIF
FMVVPFCLVSFWLAHRFVPTSSPGGSAANPQGSGLDWRGLLLATAGTLCLLNGLVELHGG
TAAAAGALLGGAVLALVAFVALERRTLQNRRLHPDQGVDPLMNLSLFKNRLFTMGSIVAF
IYGIALFGSTYLLPVYMQSGLGLSASHVGTILLPAGLVLAVVIAGVGRLADRQPTRRLVS
IGLLLLSASFALMVTIDPGRPAQIIPLLVTWAVVGRIGLGFILPSLNIGAMRDLDRADIA
QGASVISFLRMLGGSAGVSLCGIVLEWRLAAHGAQLAAGGVATPARVAAFEETFLMLAAI
CALALTAALRLKATSKPQASQ