Protein Info for GFF3022 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: D-erythrose-4-phosphate dehydrogenase (EC 1.2.1.72)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF00044: Gp_dh_N" amino acids 3 to 104 (102 residues), 122.7 bits, see alignment E=6.8e-40 TIGR01532: erythrose-4-phosphate dehydrogenase" amino acids 4 to 328 (325 residues), 646.7 bits, see alignment E=7.4e-199 TIGR01534: glyceraldehyde-3-phosphate dehydrogenase, type I" amino acids 4 to 328 (325 residues), 371 bits, see alignment E=5.6e-115 PF02800: Gp_dh_C" amino acids 160 to 316 (157 residues), 192.9 bits, see alignment E=2.8e-61

Best Hits

Swiss-Prot: 100% identical to E4PD_SALTI: D-erythrose-4-phosphate dehydrogenase (epd) from Salmonella typhi

KEGG orthology group: K03472, D-erythrose 4-phosphate dehydrogenase [EC: 1.2.1.72] (inferred from 99% identity to spt:SPA2941)

MetaCyc: 94% identical to D-erythrose-4-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Erythrose-4-phosphate dehydrogenase. [EC: 1.2.1.72]

Predicted SEED Role

"D-erythrose-4-phosphate dehydrogenase (EC 1.2.1.72)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.2.1.72)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>GFF3022 D-erythrose-4-phosphate dehydrogenase (EC 1.2.1.72) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTVRIAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFAWE
VRHEREQLFVGDDVIRILHERTLADLPWRELGVDVVLDCTGVYGNREHGEAHIAAGAKKV
LFSHPGSNDLDATVVFGVNQNQLRAEHRIVSNASCTTNCIIPVIKLLDDAYGIESGTVTT
IHSAMNDQQVIDAYHSDLRRTRAASQSIIPVDTKLAAGITRIFPQFNDRFEAIAVRVPTI
NVTAIDLSVTVKKPVKASEVNQLLQKAAQGAFHGIVDYTESPLVSIDFNHDPHSAIVDGT
QTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMAAVGFRLDASASTKL