Protein Info for GFF3017 in Variovorax sp. SCN45

Annotation: T6SS AAA+ chaperone ClpV (TssH)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 913 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 12 to 895 (884 residues), 1253.5 bits, see alignment E=0 PF02861: Clp_N" amino acids 12 to 125 (114 residues), 43.6 bits, see alignment E=1.8e-14 PF23569: NBD_SMAX1" amino acids 233 to 324 (92 residues), 33.2 bits, see alignment E=2.6e-11 PF00004: AAA" amino acids 252 to 383 (132 residues), 37 bits, see alignment E=2.4e-12 amino acids 646 to 769 (124 residues), 27.3 bits, see alignment E=2.4e-09 PF17871: AAA_lid_9" amino acids 391 to 483 (93 residues), 103 bits, see alignment E=4.3e-33 PF07724: AAA_2" amino acids 640 to 805 (166 residues), 182.4 bits, see alignment E=3.9e-57 PF07728: AAA_5" amino acids 645 to 764 (120 residues), 36.2 bits, see alignment E=3.3e-12 PF10431: ClpB_D2-small" amino acids 812 to 883 (72 residues), 43.8 bits, see alignment 1.2e-14

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 74% identity to bph:Bphy_5984)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (913 amino acids)

>GFF3017 T6SS AAA+ chaperone ClpV (TssH) (Variovorax sp. SCN45)
MDIDIRTLLGRLNPECKRAMEQAAELCVQQTHYNVDLEHLLLKLVDNDAPDLRLVFGRFS
IRPDTVQSQLQKSLDTFKRGNGRTPSLAPDFAPLFQEAWLMSSMLLGQQHIRSGTLMLAL
LDVDRLRGRLVDAAPALLQIPRGTLRDELAGLLQSSPEDAAASALAAAPVAPAPAASQHN
PPNTPSLPDAGAPPLQMPTARRGSSATPSLDQYTVDMTQLARDGAIDPIRGRDGEIRQII
DVLLRRRQNNPILTGEAGVGKTAVVEGFAQRVVQGDVPPALRQVSVRSLDLALLQAGAGV
KGEFENRLKSVIAEVKASPTPVILFIDEAHQLIGAGGAEGQGDAANLLKPALARGELRTI
AATTWAEYKKYVERDPALARRFQVVKVEEPSEEVAIDMLRGMVETLEKHHGVEIIDDAVR
EAVKLSHRYITGRQLPDKAISVLDTACARVAIGQNGLPAELESAARDIATGESELRVLRH
EAATGGEHQDAIATLTAKLDALRQKHKRLSDKLDEEKHAVMEIVALRRKIADSLRDDAPP
PDEENDPALLTAALRRLEKGLEALQSDEPMVPVCVDGVMVAEVISGWTGIPVGKMMTDEL
HTVLNLKEKLAERVVGQDDALDAIARRVRTFRADLDDPGKPVGVFMLVGPSGVGKTETAF
ALADLLYGGERNVITVNMSEFQEAHTVSSLKGAPPGYVGYGRGGVLTEAVRRRPYSVVLL
DEMEKAHPDVLELFFQVFDKGTMEDGEGVQIDFKNTLILLTSNAAQDVITQASQGGRRPD
PEELVERLRPELLKQFSPAFLGRLALVPYHHLGDEQIRSIVNLKLGKLARRFALNHHAIF
TWDEQVEDAITARCTEVDSGARNIDHILAHAVLPELSRQVLERISMAAAFTEVHMGMDGG
GAFAFRFEPATLS