Protein Info for GFF3015 in Variovorax sp. SCN45

Annotation: T6SS component TssF (ImpG/VasA)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 603 transmembrane" amino acids 560 to 582 (23 residues), see Phobius details PF05947: T6SS_TssF" amino acids 7 to 600 (594 residues), 649.2 bits, see alignment E=3.6e-199 TIGR03359: type VI secretion protein, TIGR03359 family" amino acids 9 to 603 (595 residues), 609.2 bits, see alignment E=5.3e-187

Best Hits

Predicted SEED Role

"Protein ImpG/VasA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (603 amino acids)

>GFF3015 T6SS component TssF (ImpG/VasA) (Variovorax sp. SCN45)
VSDIQHSDLLQYYKRELSYLRGQGADFAQRYPKVASRLSLHGGESLDPHTERLIESVAFL
SARVHRDLDQEFPDVAYALLDNLCPSLVQPLPSMSVAQFTLDPTQGKVTAGFRVPRHTML
NARTAHPHSAPGQAPQSRECRFRTAWDTVLWPLRVSHAAIDTDAVLRLTLECDAGTDFAE
LEIDNLRIHLQGDWMLTMPLYDALVAGVKSVGVMPEGGALQMLPPDAWREVGFAEGEEVL
PQPANAQPAYGLLQEYFAFPRKFHFFDLHHLRARLGRGQRCDLVFQLDRPTRALRHLDAE
NFQLGCTPIVNLFPRVSEPLVMDQRHYEYMLVPDRQRDATTEVHSIVSVIASDPDADKPV
NVPGFAALGHVDGAQGAQGSQGAVFWAARREPCLRQNIPGTDVFLSFVDQGKTHSRPAQP
VVYAHLLCTNRRLAEQVPVGARLVAEGPSQPTSVRCLYEPTAQRDPPLGSETLWRLVSLL
TLNHQSLVDGSTGREQLREMLLLFASDSRRDHAQIRGIAGLSARGVTAHVGTEAWRGYCR
GTQVTLEFEDDAFVGGSPLMMSAVLARFFAMYTSVNSFVRLVVRDGDEVRKQWAPMTGRQ
VVL