Protein Info for GFF3015 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Na(+)/H(+) antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 29 to 49 (21 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 227 to 256 (30 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details amino acids 299 to 324 (26 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 9 to 383 (375 residues), 116.7 bits, see alignment E=5.7e-38

Best Hits

KEGG orthology group: None (inferred from 80% identity to dar:Daro_4191)

Predicted SEED Role

"Na(+)/H(+) antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>GFF3015 Na(+)/H(+) antiporter (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNTTEIFLIAMAIIFTVPWLIWRLGRTDYWAPLVVVQIITGILLGPGVLGKAFPEYHAFV
FNPAVIQSLNGIAWWAVMLFVMIAGIELDLRQAWKHRRESGITAGLALGAPLLLGSLAAL
VMLGMPGWMGASARPWQFVLGVGMACAVTALPILILLMEKLQLLRQPLGQRILRYASVDD
IAIWGVLALILMDWQRVGKQGAFILAFVVLSWAFRHLMRRLAEADRWAVALIWLAVCAFG
ADWSGLHYMVGAFLAGVVMDAEWFDQDKLDQLRHHVLLVIMPVFFLSTGLRTNWEVGGAA
VFGMAALLLLASVSGKLIGVHLAGRVLRWPPGEASLIGWLLQTKALIMIIFANILLDKQV
ITSETFTALLLMAVASTMLTVPIVEPKLSRRAATGGSAAECAGN