Protein Info for GFF3010 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: UPF0149 exported protein YgfB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 TIGR02292: yecA family protein" amino acids 12 to 166 (155 residues), 46.7 bits, see alignment E=1.4e-16 PF03695: UPF0149" amino acids 12 to 176 (165 residues), 145.8 bits, see alignment E=8.2e-47

Best Hits

Swiss-Prot: 100% identical to YGFB_SALNS: UPF0149 protein YgfB (ygfB) from Salmonella newport (strain SL254)

KEGG orthology group: K09895, hypothetical protein (inferred from 100% identity to stt:t2977)

Predicted SEED Role

"FIG001590: Putative conserved exported protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>GFF3010 UPF0149 exported protein YgfB (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSIQNEMPGYNEMNRFLNQQGAGLTPAEMHGLISGMICGGNNDSSWQPLLHDLTNEGLAF
GHELAQALRKMHAATSDALEDDGFLFQLYLPEGDDVSVFDRADALAGWVNHFLLGLGVTQ
PKLDKVTGETGEAIDDLRNIAQLGYDESEDQEELEMSLEEIIEYVRVAALLCHDTFTRQQ
PTAPEVRKPTLH