Protein Info for GFF3008 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG025233: SAM-dependent methyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF13489: Methyltransf_23" amino acids 31 to 162 (132 residues), 31.3 bits, see alignment E=4e-11 PF08242: Methyltransf_12" amino acids 47 to 158 (112 residues), 37.7 bits, see alignment E=7e-13 PF08241: Methyltransf_11" amino acids 47 to 159 (113 residues), 29.4 bits, see alignment E=2.6e-10 PF13649: Methyltransf_25" amino acids 47 to 156 (110 residues), 36.4 bits, see alignment E=1.7e-12 PF00891: Methyltransf_2" amino acids 99 to 158 (60 residues), 25.8 bits, see alignment E=1.6e-09

Best Hits

KEGG orthology group: None (inferred from 68% identity to dar:Daro_4180)

Predicted SEED Role

"FIG025233: SAM-dependent methyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>GFF3008 FIG025233: SAM-dependent methyltransferases (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLVNEASQTFLPSGRFAYHYARGKLGYDSIFHEVLRRGLLPEGGHYLDLGCGQGSLFAWL
LAAGRLHAQGHWPAGWAPPPEPKKLRGIELMQRDVDRAARAFGPQHPVVRVEQGDMNAVD
FGRPDAILILDALHYFSHEQQREVLARIRQALPPGGVFLTRIGDAGAGLTYRICNGVDRL
VTYTRGHRLPRLYCRTLQDWVAELQHLGFVVETEPMSGRKPFANVMLVCRVPH