Protein Info for GFF3005 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG021862: membrane protein, exporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 779 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 248 to 267 (20 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 299 to 322 (24 residues), see Phobius details amino acids 342 to 359 (18 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details amino acids 412 to 430 (19 residues), see Phobius details amino acids 640 to 658 (19 residues), see Phobius details amino acids 665 to 686 (22 residues), see Phobius details amino acids 692 to 713 (22 residues), see Phobius details amino acids 725 to 745 (21 residues), see Phobius details amino acids 751 to 774 (24 residues), see Phobius details PF03176: MMPL" amino acids 175 to 388 (214 residues), 36.5 bits, see alignment E=1.4e-13

Best Hits

KEGG orthology group: None (inferred from 51% identity to bcj:BCAL0840)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (779 amino acids)

>GFF3005 FIG021862: membrane protein, exporter (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTRSVWRALLIWLAAMAVGLGLLWNTRFSADVSFFLPSKPTPEQAVMVDQLREGAVSRLL
MLAIAGGSPDQRADASRALRAALKEEASLDTVQNGEAEALDAARDFLLDHRYVLSSAVTP
ERFSVEGLRSAVNHSVDLLSSSAGLLFKPYLARDPTGELVELVSGLNAGVQPNEQDGVWA
SRDGERAMLVVQTHALGSDTDGQAAAIDLIRERFAKVVEQPGLQGLALEMSGPGLFAVRA
RATIQEEVSRLSLISTAILAVMLGFIYRRGRLMLLTLVPVLSGTLAAIVAVGLVHGTVFG
ITVGFGAALIGEAVDYAIYYFVQSGRQGVGSWREQYWPTIRLGVLTSVLGFGALLFSGFP
GLAQLGLYAITGVLTAALVTRYLLPQLAGPGVHLHDGASKGRLLRPLVERATVLRWPLLA
LVLVSAVYLVKERNDLWQSDLSALSTVSQAEGELDARLRGDLGAPDARYMAVITAPDRES
ALQAAERAGAKLRPLVEQGLIGGYDTPARFLPSEATQAARRASLPTPEELRERLRAALVD
APLSADRLQPFLDDVAAARQAPPLTREALEGTGLGLAVDALLMQRPNGWSVLLPLRPSAE
ATGADIPVAAVREALAGSGALFIDLKGEFDTLYGEYIDEAIVLSLAGFLAIVVAMAFVQR
SALRLASVMLPLVMAVVVVIAGLHVFGVHLHLLHLVGMLLTVAVGSNYALFFDRLALGEE
LDDETLLSIGVASFTTVVGFGVLAWSTVPVLHAIGVTVGPGAVLALVLSAAFAVRRPAA