Protein Info for GFF3004 in Variovorax sp. SCN45

Annotation: Thymidylate synthase (EC 2.1.1.45)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF00303: Thymidylat_synt" amino acids 21 to 289 (269 residues), 424.7 bits, see alignment E=5.9e-132 TIGR03284: thymidylate synthase" amino acids 21 to 103 (83 residues), 122.5 bits, see alignment E=9.6e-40 amino acids 103 to 289 (187 residues), 293.8 bits, see alignment E=6.7e-92

Best Hits

Swiss-Prot: 91% identical to TYSY_POLSJ: Thymidylate synthase (thyA) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 96% identity to vap:Vapar_1664)

MetaCyc: 70% identical to thymidylate synthase (Escherichia coli K-12 substr. MG1655)
Thymidylate synthase. [EC: 2.1.1.45]

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.45

Use Curated BLAST to search for 2.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>GFF3004 Thymidylate synthase (EC 2.1.1.45) (Variovorax sp. SCN45)
MLAPPRKIPNMTSPIRPVRSQYEDFMRHVDTHGVFKSDRTGTGTKSVFGHQMRFDLNEGF
PLVTTKKVHLKSIIQELLWFLTGSSNNNWLKERGVTIWDEWAREDGDLGPVYGVQWRSWP
TPDGGHIDQIADVIKTLKSNPDSRRIIVSAWNVAELSKMALMPCHAFFQFYVAPPQAEGE
RGKLSCQLYQRSADIFLGVPFNIASYALLTHMVAQQCDLDVGDFIWTGGDCHIYSNHAEQ
VALQLSRAPYPYPTLHIKRKPDSIFDYQYEDFEVLDYQHHAAIKAPVAV