Protein Info for PS417_15365 in Pseudomonas simiae WCS417

Annotation: diaminopimelate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 48% identical to DAPF_RHOS4: Diaminopimelate epimerase (dapF) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K01778, diaminopimelate epimerase [EC: 5.1.1.7] (inferred from 86% identity to pfs:PFLU3556)

Predicted SEED Role

"Diaminopimelate epimerase (EC 5.1.1.7)" in subsystem Lysine Biosynthesis DAP Pathway (EC 5.1.1.7)

MetaCyc Pathways

aspartate superpathway (22/25 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
L-lysine biosynthesis I (9/9 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
L-lysine biosynthesis VI (6/7 steps found)
L-lysine biosynthesis II (6/9 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.1.7

Use Curated BLAST to search for 5.1.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UAK9 at UniProt or InterPro

Protein Sequence (267 amino acids)

>PS417_15365 diaminopimelate epimerase (Pseudomonas simiae WCS417)
MPLPFVKMHAHGDDFIIIDRRGLHDPITAKVARQLGNRHTGIGFNQLAVLLDCDDAAARI
KFWNPNGTLLATCGSATRGVADRLMHEAGTDSVVLRTDRGLLTCARAAGRQISVNMGEPS
LDWSAVPLAEAMDTLTLPIDGNPAACSMGNPHCTFFVEDLTAVDVATVGPALEIHPLFPA
KTNVHFVQVLDRGHIRLRIWERGGGVPLGSGSCCCGAVVNGIRRGLLDATVQVHCDGGTV
TVHWAGEGAVVLTGSVEPVMQGSAYVG