Protein Info for GFF3002 in Variovorax sp. SCN45

Annotation: Cobalt-containing nitrile hydratase subunit beta (EC 4.2.1.84)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21006: NHase_beta_N
  • amino acids 7 to 109 (103 residues), 101.1 bits, E=4.1e-33
• TIGR03888: nitrile hydratase, beta subunit
  • amino acids 8 to 220 (213 residues), 207.7 bits, E=1.1e-65
• PF02211: NHase_beta_C
  • amino acids 122 to 218 (97 residues), 114.8 bits, E=2.2e-37

Best Hits

KEGG orthology group: K01721, nitrile hydratase [EC: 4.2.1.84] (inferred from 86% identity to vap:Vapar_1666)

Predicted SEED Role

"Cobalt-containing nitrile hydratase subunit beta (EC 4.2.1.84)" (EC 4.2.1.84)

MetaCyc Pathways

• aldoxime degradation (3/3 steps found)
• superpathway of acrylonitrile degradation (3/3 steps found)
• acrylonitrile degradation I (2/2 steps found)
• indole-3-acetate biosynthesis IV (bacteria) (2/2 steps found)
• indole-3-acetate biosynthesis II (5/12 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via CoA ligation
• Cyanoamino acid metabolism
• Styrene degradation
• Tryptophan metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.84

Use Curated BLAST to search for 4.2.1.84

Protein Sequence (221 amino acids)

>GFF3002 Cobalt-containing nitrile hydratase subunit beta (EC 4.2.1.84) (Variovorax sp. SCN45)
MSYVTRADLGGLPGFGPVTPEPEGELFHAAWEPRVLALTLAMGATGSWNIDASRAVRETL
PDYRDLSYYQIWLAALEQLMLQRGQIFPDEITTGEMHHAAVPVARVLQAANVPAVLARGS
ATERPATGPARFAIGQPVRMRLGKVDHHTRLPGYVQGKQGVIAHLHGAHVFADANAQGLG
EQPQWLYTVAFDEAELWGDEAPRQNLSVSVDAWESYLEAVE