Protein Info for PS417_15355 in Pseudomonas simiae WCS417

Annotation: sigma factor sigB regulation protein rsbQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF12146: Hydrolase_4" amino acids 18 to 245 (228 residues), 40.2 bits, see alignment E=5.2e-14 PF00561: Abhydrolase_1" amino acids 18 to 250 (233 residues), 72.2 bits, see alignment E=1.1e-23 PF12697: Abhydrolase_6" amino acids 19 to 256 (238 residues), 74.1 bits, see alignment E=5.2e-24

Best Hits

Swiss-Prot: 43% identical to RSBQ_BACSU: Sigma factor SigB regulation protein RsbQ (rsbQ) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 88% identity to pfs:PFLU3554)

Predicted SEED Role

"Hydrolase of unknown specificity RsbQ, part of a novel [RsbQ - PAS domain] bacterial sensing module"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U4G0 at UniProt or InterPro

Protein Sequence (271 amino acids)

>PS417_15355 sigma factor sigB regulation protein rsbQ (Pseudomonas simiae WCS417)
MDLRHRNNVSVMGNGSSTLVFSHGFGCNQAMWNYLAPQFSERFRVVMYDLVGAGLSDLSA
FDKAKYSSLDGYARDLNEIIDAFAVGPVILVSHSVSAMISTLADRQAPNRIAAHVMIGPS
PRYIDADGYVGGFKRGDIQDLLDTLDSNYLGWSSAMAPVIMGAPGQPALSQELTDSFCRT
EPEIAKQFARVTFMSDNRQDVIGLATPVLVLQSSDDLIAPVAVGEYLHSVLPNSTYCLVD
NVGHCPHMSAPHACATAMHSFLAPWAAARAD