Protein Info for GFF300 in Variovorax sp. SCN45

Annotation: Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00125: cytidyltransferase-like domain
  • amino acids 11 to 68 (58 residues), 38.4 bits, E=1.1e-13
• PF01467: CTP_transf_like
  • amino acids 13 to 182 (170 residues), 77.9 bits, E=4.3e-26
• TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase
  • amino acids 13 to 207 (195 residues), 151.7 bits, E=2.5e-48

Best Hits

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 92% identity to vap:Vapar_2686)

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD de novo biosynthesis II (from tryptophan) (8/9 steps found)
• NAD salvage pathway II (PNC IV cycle) (5/5 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• superpathway of NAD biosynthesis in eukaryotes (11/14 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• NAD salvage (plants) (6/11 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Protein Sequence (210 amino acids)

>GFF300 Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Variovorax sp. SCN45)
VNSSSGKAPRIGVFGGAFDPPHNAHVALAEAALAQLDLAELHVIPTGQAWHKSRALTPKE
DRLAMTRLAFTGLKGTVVIDSREVLRDGPTYTLDTLHELQQEQPGAQLVLIMGADQASAL
PTWHGWQDILGIAIVSVAYRALSTGDTARFDPKMLPGLPAGARFEALELPPMDISATEIR
RRAALGVDISSLVPATVARYIDQHHLYRSA