Protein Info for GFF3 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 PF07411: DUF1508" amino acids 12 to 55 (44 residues), 61.6 bits, see alignment E=2.6e-21 amino acids 61 to 107 (47 residues), 64.2 bits, see alignment E=4e-22

Best Hits

Swiss-Prot: 64% identical to Y445_BORBR: UPF0339 protein BB0445 (BB0445) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K09946, hypothetical protein (inferred from 64% identity to bbr:BB0445)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>GFF3 hypothetical protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAAYFHLKPSGTQWMFNLVGGNHETILTSERYTSKQGAQGGIASVKANAPIDARYARLTN
SAGKPYFVLKAANGEPLGTSEAYSSAATRDQGIEAVKSAAPGAATRE