Protein Info for PS417_01525 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 transmembrane" amino acids 8 to 27 (20 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 112 to 128 (17 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 163 to 189 (27 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 259 to 276 (18 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 344 to 366 (23 residues), see Phobius details amino acids 377 to 395 (19 residues), see Phobius details amino acids 402 to 421 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 91% identity to pfs:PFLU0319)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UBF5 at UniProt or InterPro

Protein Sequence (530 amino acids)

>PS417_01525 membrane protein (Pseudomonas simiae WCS417)
MDHRNRFRLESLVIFLFAMLLFTLGIWDQQPQGFDGRWALFLQEMFRHGASLFPTTYGQP
YADYPGTATFLSFVVARLFGAPNHLANVLPTALASAGVVTLIYRLLVPANRQWALLTVLL
TLLTTQLLEKSRSVCLDQMVALLCVGSFYLLHSGGRWRRLAVFPLFILGFAIRGPLGLIE
VCGVVCVYWALGKPGERVKQVLIHGAVGLVLLAICWWLLMKLARISGGDAFADEVFRMQV
GGRLDETGEPFYFYFQLSLYRYFPVVPLALATMIALRHRWSERFEGDLQWVARLGACGLM
ILLGLSVPHFKRAYYVLPMVPMFAAVAAYGLLQAPGWLSGVRRCYEGLIVALPALCVVVV
FVCRHGWQKQGYWPDVSLPLLIGVLAVLQVAALIAWRRVGRLVWLSLIALMAQWLLLVTV
VEPAKDLQFDTRKFVGQVEAMRATAPGPLVFINLGRDTWAVRYMMNLNHDEQPVFIGRAE
LDQLEGVPRPAWVIVARKETALLKGTALEHQHAVFSGRLNDNPLMVFLLN